LAMC2 polyclonal antibody (A01)
  • LAMC2 polyclonal antibody (A01)

LAMC2 polyclonal antibody (A01)

Ref: AB-H00003918-A01
LAMC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LAMC2.
Información adicional
Size 50 uL
Gene Name LAMC2
Gene Alias B2T|BM600|CSF|EBR2|EBR2A|LAMB2T|LAMNB2|MGC138491|MGC141938
Gene Description laminin, gamma 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMC2 (NP_005553, 1084 a.a. ~ 1193 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3918

Enviar un mensaje


LAMC2 polyclonal antibody (A01)

LAMC2 polyclonal antibody (A01)