Ver mas grande
LAMC2 polyclonal antibody (A01)
AB-H00003918-A01
Producto nuevo
LAMC2 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | LAMC2 |
| Gene Alias | B2T|BM600|CSF|EBR2|EBR2A|LAMB2T|LAMNB2|MGC138491|MGC141938 |
| Gene Description | laminin, gamma 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | VDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LAMC2 (NP_005553, 1084 a.a. ~ 1193 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 3918 |
Más información
Mouse polyclonal antibody raised against a partial recombinant LAMC2.