LAMA4 MaxPab mouse polyclonal antibody (B02)
  • LAMA4 MaxPab mouse polyclonal antibody (B02)

LAMA4 MaxPab mouse polyclonal antibody (B02)

Ref: AB-H00003910-B02
LAMA4 MaxPab mouse polyclonal antibody (B02)

Información del producto

Mouse polyclonal antibody raised against a full-length human LAMA4 protein.
Información adicional
Size 50 uL
Gene Name LAMA4
Gene Alias DKFZp686D23145|LAMA3|LAMA4*-1
Gene Description laminin, alpha 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LAMA4 (AAH04241.1, 1 a.a. ~ 120 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3910

Enviar un mensaje


LAMA4 MaxPab mouse polyclonal antibody (B02)

LAMA4 MaxPab mouse polyclonal antibody (B02)