LAMA3 polyclonal antibody (A01) Ver mas grande

LAMA3 polyclonal antibody (A01)

AB-H00003909-A01

Producto nuevo

LAMA3 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name LAMA3
Gene Alias BM600|E170|LAMNA|LOCS|lama3a
Gene Description laminin, alpha 3
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSQQQRVPFLQPPGQSQLQASYVEFRPSQGCSPGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNSFATGCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMA3 (NP_000218, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3909

Más información

Mouse polyclonal antibody raised against a partial recombinant LAMA3.

Consulta sobre un producto

LAMA3 polyclonal antibody (A01)

LAMA3 polyclonal antibody (A01)