LAMA3 polyclonal antibody (A01)
  • LAMA3 polyclonal antibody (A01)

LAMA3 polyclonal antibody (A01)

Ref: AB-H00003909-A01
LAMA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LAMA3.
Información adicional
Size 50 uL
Gene Name LAMA3
Gene Alias BM600|E170|LAMNA|LOCS|lama3a
Gene Description laminin, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSQQQRVPFLQPPGQSQLQASYVEFRPSQGCSPGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNSFATGCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMA3 (NP_000218, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3909

Enviar un mensaje


LAMA3 polyclonal antibody (A01)

LAMA3 polyclonal antibody (A01)