LALBA polyclonal antibody (A01)
  • LALBA polyclonal antibody (A01)

LALBA polyclonal antibody (A01)

Ref: AB-H00003906-A01
LALBA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LALBA.
Información adicional
Size 50 uL
Gene Name LALBA
Gene Alias MGC138521|MGC138523
Gene Description lactalbumin, alpha-
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LALBA (NP_002280, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3906

Enviar un mensaje


LALBA polyclonal antibody (A01)

LALBA polyclonal antibody (A01)