LAG3 purified MaxPab mouse polyclonal antibody (B01P)
  • LAG3 purified MaxPab mouse polyclonal antibody (B01P)

LAG3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003902-B01P
LAG3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LAG3 protein.
Información adicional
Size 50 ug
Gene Name LAG3
Gene Alias CD223
Gene Description lymphocyte-activation gene 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LAG3 (AAH52589.1, 1 a.a. ~ 360 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3902

Enviar un mensaje


LAG3 purified MaxPab mouse polyclonal antibody (B01P)

LAG3 purified MaxPab mouse polyclonal antibody (B01P)