KRT83 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT83 purified MaxPab rabbit polyclonal antibody (D01P)

KRT83 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003889-D01P
KRT83 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT83 protein.
Información adicional
Size 100 ug
Gene Name KRT83
Gene Alias HB3|Hb-3|KRTHB3|MGC141663
Gene Description keratin 83
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFAGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT83 (AAH69546.1, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3889

Enviar un mensaje


KRT83 purified MaxPab rabbit polyclonal antibody (D01P)

KRT83 purified MaxPab rabbit polyclonal antibody (D01P)