KRT18 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT18 purified MaxPab rabbit polyclonal antibody (D01P)

KRT18 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003875-D01P
KRT18 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT18 protein.
Información adicional
Size 100 ug
Gene Name KRT18
Gene Alias CYK18|K18
Gene Description keratin 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT18 (NP_000215.1, 1 a.a. ~ 430 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3875

Enviar un mensaje


KRT18 purified MaxPab rabbit polyclonal antibody (D01P)

KRT18 purified MaxPab rabbit polyclonal antibody (D01P)