KRT14 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT14 purified MaxPab rabbit polyclonal antibody (D01P)

KRT14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003861-D01P
KRT14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT14 protein.
Información adicional
Size 100 ug
Gene Name KRT14
Gene Alias CK14|EBS3|EBS4|K14|NFJ
Gene Description keratin 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGAYGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT14 (NP_000517.2, 1 a.a. ~ 472 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3861

Enviar un mensaje


KRT14 purified MaxPab rabbit polyclonal antibody (D01P)

KRT14 purified MaxPab rabbit polyclonal antibody (D01P)