KRT8 monoclonal antibody (M02), clone 3E3
  • KRT8 monoclonal antibody (M02), clone 3E3

KRT8 monoclonal antibody (M02), clone 3E3

Ref: AB-H00003856-M02
KRT8 monoclonal antibody (M02), clone 3E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KRT8.
Información adicional
Size 100 ug
Gene Name KRT8
Gene Alias CARD2|CK8|CYK8|K2C8|K8|KO
Gene Description keratin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KRT8 (NP_002264, 91 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3856
Clone Number 3E3
Iso type IgG2b Kappa

Enviar un mensaje


KRT8 monoclonal antibody (M02), clone 3E3

KRT8 monoclonal antibody (M02), clone 3E3