KRT8 polyclonal antibody (A01)
  • KRT8 polyclonal antibody (A01)

KRT8 polyclonal antibody (A01)

Ref: AB-H00003856-A01
KRT8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KRT8.
Información adicional
Size 50 uL
Gene Name KRT8
Gene Alias CARD2|CK8|CYK8|K2C8|K8|KO
Gene Description keratin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KRT8 (NP_002264, 91 a.a. ~ 195 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3856

Enviar un mensaje


KRT8 polyclonal antibody (A01)

KRT8 polyclonal antibody (A01)