KRT4 monoclonal antibody (M01), clone 5H5
  • KRT4 monoclonal antibody (M01), clone 5H5

KRT4 monoclonal antibody (M01), clone 5H5

Ref: AB-H00003851-M01
KRT4 monoclonal antibody (M01), clone 5H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KRT4.
Información adicional
Size 100 ug
Gene Name KRT4
Gene Alias CK4|CYK4|FLJ31692|K4
Gene Description keratin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KRT4 (NP_002263, 194 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3851
Clone Number 5H5
Iso type IgG1 Kappa

Enviar un mensaje


KRT4 monoclonal antibody (M01), clone 5H5

KRT4 monoclonal antibody (M01), clone 5H5