KRT4 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT4 purified MaxPab rabbit polyclonal antibody (D01P)

KRT4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003851-D01P
KRT4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT4 protein.
Información adicional
Size 100 ug
Gene Name KRT4
Gene Alias CK4|CYK4|FLJ31692|K4
Gene Description keratin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT4 (AAH42174.1, 1 a.a. ~ 534 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3851

Enviar un mensaje


KRT4 purified MaxPab rabbit polyclonal antibody (D01P)

KRT4 purified MaxPab rabbit polyclonal antibody (D01P)