KRT1 monoclonal antibody (M01), clone 2A7
  • KRT1 monoclonal antibody (M01), clone 2A7

KRT1 monoclonal antibody (M01), clone 2A7

Ref: AB-H00003848-M01
KRT1 monoclonal antibody (M01), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KRT1.
Información adicional
Size 100 ug
Gene Name KRT1
Gene Alias CK1|EHK1|K1|KRT1A
Gene Description keratin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KRT1 (NP_006112, 387 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3848
Clone Number 2A7
Iso type IgG2a Kappa

Enviar un mensaje


KRT1 monoclonal antibody (M01), clone 2A7

KRT1 monoclonal antibody (M01), clone 2A7