RANBP5 monoclonal antibody (M01), clone 1C4
  • RANBP5 monoclonal antibody (M01), clone 1C4

RANBP5 monoclonal antibody (M01), clone 1C4

Ref: AB-H00003843-M01
RANBP5 monoclonal antibody (M01), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RANBP5.
Información adicional
Size 100 ug
Gene Name IPO5
Gene Alias DKFZp686O1576|FLJ43041|IMB3|KPNB3|MGC2068|RANBP5
Gene Description importin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RANBP5 (AAH01497, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3843
Clone Number 1C4
Iso type IgG1 Kappa

Enviar un mensaje


RANBP5 monoclonal antibody (M01), clone 1C4

RANBP5 monoclonal antibody (M01), clone 1C4