KPNA5 purified MaxPab rabbit polyclonal antibody (D01P)
  • KPNA5 purified MaxPab rabbit polyclonal antibody (D01P)

KPNA5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003841-D01P
KPNA5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KPNA5 protein.
Información adicional
Size 100 ug
Gene Name KPNA5
Gene Alias IPOA6|SRP6
Gene Description karyopherin alpha 5 (importin alpha 6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KPNA5 (NP_002260.2, 1 a.a. ~ 539 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3841

Enviar un mensaje


KPNA5 purified MaxPab rabbit polyclonal antibody (D01P)

KPNA5 purified MaxPab rabbit polyclonal antibody (D01P)