KPNA3 polyclonal antibody (A01)
  • KPNA3 polyclonal antibody (A01)

KPNA3 polyclonal antibody (A01)

Ref: AB-H00003839-A01
KPNA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KPNA3.
Información adicional
Size 50 uL
Gene Name KPNA3
Gene Alias IPOA4|SRP1|SRP1gamma|SRP4|hSRP1
Gene Description karyopherin alpha 3 (importin alpha 4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KPNA3 (NP_002258, 422 a.a. ~ 521 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3839

Enviar un mensaje


KPNA3 polyclonal antibody (A01)

KPNA3 polyclonal antibody (A01)