KPNA1 monoclonal antibody (M01), clone 2A4-1B5
  • KPNA1 monoclonal antibody (M01), clone 2A4-1B5

KPNA1 monoclonal antibody (M01), clone 2A4-1B5

Ref: AB-H00003836-M01
KPNA1 monoclonal antibody (M01), clone 2A4-1B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant KPNA1.
Información adicional
Size 100 ug
Gene Name KPNA1
Gene Alias IPOA5|NPI-1|RCH2|SRP1
Gene Description karyopherin alpha 1 (importin alpha 5)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3836
Clone Number 2A4-1B5
Iso type IgG1 Kappa

Enviar un mensaje


KPNA1 monoclonal antibody (M01), clone 2A4-1B5

KPNA1 monoclonal antibody (M01), clone 2A4-1B5