KPNA1 polyclonal antibody (A02)
  • KPNA1 polyclonal antibody (A02)

KPNA1 polyclonal antibody (A02)

Ref: AB-H00003836-A02
KPNA1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant KPNA1.
Información adicional
Size 50 uL
Gene Name KPNA1
Gene Alias IPOA5|NPI-1|RCH2|SRP1
Gene Description karyopherin alpha 1 (importin alpha 5)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3836

Enviar un mensaje


KPNA1 polyclonal antibody (A02)

KPNA1 polyclonal antibody (A02)