KNG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • KNG1 purified MaxPab rabbit polyclonal antibody (D01P)

KNG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003827-D01P
KNG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KNG1 protein.
Información adicional
Size 100 ug
Gene Name KNG1
Gene Alias BDK|KNG
Gene Description kininogen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KNG1 (NP_000884.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3827

Enviar un mensaje


KNG1 purified MaxPab rabbit polyclonal antibody (D01P)

KNG1 purified MaxPab rabbit polyclonal antibody (D01P)