KLRB1 monoclonal antibody (M01J), clone 2F3
  • KLRB1 monoclonal antibody (M01J), clone 2F3

KLRB1 monoclonal antibody (M01J), clone 2F3

Ref: AB-H00003820-M01J
KLRB1 monoclonal antibody (M01J), clone 2F3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant KLRB1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name KLRB1
Gene Alias CD161|CLEC5B|MGC138614|NKR|NKR-P1|NKR-P1A|NKRP1A|hNKR-P1A
Gene Description killer cell lectin-like receptor subfamily B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLRB1 (NP_002249, 126 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3820
Clone Number 2F3
Iso type IgG1 Kappa

Enviar un mensaje


KLRB1 monoclonal antibody (M01J), clone 2F3

KLRB1 monoclonal antibody (M01J), clone 2F3