KLRB1 polyclonal antibody (A01)
  • KLRB1 polyclonal antibody (A01)

KLRB1 polyclonal antibody (A01)

Ref: AB-H00003820-A01
KLRB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLRB1.
Información adicional
Size 50 uL
Gene Name KLRB1
Gene Alias CD161|CLEC5B|MGC138614|NKR|NKR-P1|NKR-P1A|NKRP1A|hNKR-P1A
Gene Description killer cell lectin-like receptor subfamily B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLRB1 (NP_002249, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3820

Enviar un mensaje


KLRB1 polyclonal antibody (A01)

KLRB1 polyclonal antibody (A01)