KLK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • KLK2 purified MaxPab rabbit polyclonal antibody (D01P)

KLK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003817-D01P
KLK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KLK2 protein.
Información adicional
Size 100 ug
Gene Name KLK2
Gene Alias KLK2A2|MGC12201|hK2
Gene Description kallikrein-related peptidase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGVSHPYSQHLEGKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLK2 (NP_001002231.1, 1 a.a. ~ 223 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3817

Enviar un mensaje


KLK2 purified MaxPab rabbit polyclonal antibody (D01P)

KLK2 purified MaxPab rabbit polyclonal antibody (D01P)