Ver mas grande
KLK2 MaxPab rabbit polyclonal antibody (D01)
AB-H00003817-D01
Producto nuevo
KLK2 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | KLK2 |
| Gene Alias | KLK2A2|MGC12201|hK2 |
| Gene Description | kallikrein-related peptidase 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGVSHPYSQHLEGKG |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | KLK2 (NP_001002231.1, 1 a.a. ~ 223 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 3817 |
Más información
Rabbit polyclonal antibody raised against a full-length human KLK2 protein.