KLK1 monoclonal antibody (M01), clone 3G2
  • KLK1 monoclonal antibody (M01), clone 3G2

KLK1 monoclonal antibody (M01), clone 3G2

Ref: AB-H00003816-M01
KLK1 monoclonal antibody (M01), clone 3G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLK1.
Información adicional
Size 100 ug
Gene Name KLK1
Gene Alias KLKR|Klk6|hK1
Gene Description kallikrein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK1 (AAH05313, 168 a.a. ~ 262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3816
Clone Number 3G2
Iso type IgG2a Kappa

Enviar un mensaje


KLK1 monoclonal antibody (M01), clone 3G2

KLK1 monoclonal antibody (M01), clone 3G2