KLK1 purified MaxPab mouse polyclonal antibody (B01P)
  • KLK1 purified MaxPab mouse polyclonal antibody (B01P)

KLK1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003816-B01P
KLK1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KLK1 protein.
Información adicional
Size 50 ug
Gene Name KLK1
Gene Alias KLKR|Klk6|hK1
Gene Description kallikrein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLK1 (NP_002248.1, 1 a.a. ~ 262 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3816

Enviar un mensaje


KLK1 purified MaxPab mouse polyclonal antibody (B01P)

KLK1 purified MaxPab mouse polyclonal antibody (B01P)