KIT monoclonal antibody (M06), clone 5A11
  • KIT monoclonal antibody (M06), clone 5A11

KIT monoclonal antibody (M06), clone 5A11

Ref: AB-H00003815-M06
KIT monoclonal antibody (M06), clone 5A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KIT.
Información adicional
Size 100 ug
Gene Name KIT
Gene Alias C-Kit|CD117|PBT|SCFR
Gene Description v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIT (NP_000213, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3815
Clone Number 5A11
Iso type IgG2b Kappa

Enviar un mensaje


KIT monoclonal antibody (M06), clone 5A11

KIT monoclonal antibody (M06), clone 5A11