KIT purified MaxPab rabbit polyclonal antibody (D01P)
  • KIT purified MaxPab rabbit polyclonal antibody (D01P)

KIT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003815-D01P
KIT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIT protein.
Información adicional
Size 100 ug
Gene Name KIT
Gene Alias C-Kit|CD117|PBT|SCFR
Gene Description v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIT (AAH71593.1, 1 a.a. ~ 976 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3815

Enviar un mensaje


KIT purified MaxPab rabbit polyclonal antibody (D01P)

KIT purified MaxPab rabbit polyclonal antibody (D01P)