KIF2 monoclonal antibody (M01), clone 2D4
  • KIF2 monoclonal antibody (M01), clone 2D4

KIF2 monoclonal antibody (M01), clone 2D4

Ref: AB-H00003796-M01
KIF2 monoclonal antibody (M01), clone 2D4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant KIF2.
Información adicional
Size 100 ug
Gene Name KIF2A
Gene Alias HK2|KIF2
Gene Description kinesin heavy chain member 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIF2 (AAH31828.1, 1 a.a. ~ 679 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3796
Clone Number 2D4
Iso type IgG1 kappa

Enviar un mensaje


KIF2 monoclonal antibody (M01), clone 2D4

KIF2 monoclonal antibody (M01), clone 2D4