KHK MaxPab rabbit polyclonal antibody (D01)
  • KHK MaxPab rabbit polyclonal antibody (D01)

KHK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003795-D01
KHK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KHK protein.
Información adicional
Size 100 uL
Gene Name KHK
Gene Alias -
Gene Description ketohexokinase (fructokinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KHK (AAH06233.1, 1 a.a. ~ 298 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3795

Enviar un mensaje


KHK MaxPab rabbit polyclonal antibody (D01)

KHK MaxPab rabbit polyclonal antibody (D01)