KCNN4 purified MaxPab mouse polyclonal antibody (B01P)
  • KCNN4 purified MaxPab mouse polyclonal antibody (B01P)

KCNN4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003783-B01P
KCNN4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KCNN4 protein.
Información adicional
Size 50 ug
Gene Name KCNN4
Gene Alias IK1|IKCA1|KCA4|KCa3.1|SK4|hIKCa1|hKCa4|hSK4
Gene Description potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KCNN4 (NP_002241.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3783

Enviar un mensaje


KCNN4 purified MaxPab mouse polyclonal antibody (B01P)

KCNN4 purified MaxPab mouse polyclonal antibody (B01P)