KCNH1 polyclonal antibody (A01)
  • KCNH1 polyclonal antibody (A01)

KCNH1 polyclonal antibody (A01)

Ref: AB-H00003756-A01
KCNH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KCNH1.
Información adicional
Size 50 uL
Gene Name KCNH1
Gene Alias EAG|EAG1|Kv10.1|MGC142269|h-eag
Gene Description potassium voltage-gated channel, subfamily H (eag-related), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNH1 (NP_758872, 890 a.a. ~ 988 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3756

Enviar un mensaje


KCNH1 polyclonal antibody (A01)

KCNH1 polyclonal antibody (A01)