KCNE1 monoclonal antibody (M13), clone 2A6
  • KCNE1 monoclonal antibody (M13), clone 2A6

KCNE1 monoclonal antibody (M13), clone 2A6

Ref: AB-H00003753-M13
KCNE1 monoclonal antibody (M13), clone 2A6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant KCNE1.
Información adicional
Size 100 ug
Gene Name KCNE1
Gene Alias FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK
Gene Description potassium voltage-gated channel, Isk-related family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNE1 (AAH36452, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3753
Clone Number 2A6
Iso type IgG2a Kappa

Enviar un mensaje


KCNE1 monoclonal antibody (M13), clone 2A6

KCNE1 monoclonal antibody (M13), clone 2A6