KCNE1 MaxPab rabbit polyclonal antibody (D01)
  • KCNE1 MaxPab rabbit polyclonal antibody (D01)

KCNE1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003753-D01
KCNE1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KCNE1 protein.
Información adicional
Size 100 uL
Gene Name KCNE1
Gene Alias FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK
Gene Description potassium voltage-gated channel, Isk-related family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KCNE1 (NP_000210.2, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3753

Enviar un mensaje


KCNE1 MaxPab rabbit polyclonal antibody (D01)

KCNE1 MaxPab rabbit polyclonal antibody (D01)