KCNE1 polyclonal antibody (A01)
  • KCNE1 polyclonal antibody (A01)

KCNE1 polyclonal antibody (A01)

Ref: AB-H00003753-A01
KCNE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KCNE1.
Información adicional
Size 50 uL
Gene Name KCNE1
Gene Alias FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK
Gene Description potassium voltage-gated channel, Isk-related family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3753

Enviar un mensaje


KCNE1 polyclonal antibody (A01)

KCNE1 polyclonal antibody (A01)