JAK1 polyclonal antibody (A01)
  • JAK1 polyclonal antibody (A01)

JAK1 polyclonal antibody (A01)

Ref: AB-H00003716-A01
JAK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant JAK1.
Información adicional
Size 50 uL
Gene Name JAK1
Gene Alias JAK1A|JAK1B|JTK3
Gene Description Janus kinase 1 (a protein tyrosine kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen JAK1 (NP_002218, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3716

Enviar un mensaje


JAK1 polyclonal antibody (A01)

JAK1 polyclonal antibody (A01)