ITPR1 polyclonal antibody (A01)
  • ITPR1 polyclonal antibody (A01)

ITPR1 polyclonal antibody (A01)

Ref: AB-H00003708-A01
ITPR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITPR1.
Información adicional
Size 50 uL
Gene Name ITPR1
Gene Alias INSP3R1|IP3R|IP3R1|SCA15|SCA16
Gene Description inositol 1,4,5-triphosphate receptor, type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITPR1 (NP_002213, 2470 a.a. ~ 2577 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3708

Enviar un mensaje


ITPR1 polyclonal antibody (A01)

ITPR1 polyclonal antibody (A01)