ITK polyclonal antibody (A01)
  • ITK polyclonal antibody (A01)

ITK polyclonal antibody (A01)

Ref: AB-H00003702-A01
ITK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITK.
Información adicional
Size 50 uL
Gene Name ITK
Gene Alias EMT|LYK|MGC126257|MGC126258|PSCTK2
Gene Description IL2-inducible T-cell kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITK (NP_005537, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3702

Enviar un mensaje


ITK polyclonal antibody (A01)

ITK polyclonal antibody (A01)