ITGB8 purified MaxPab mouse polyclonal antibody (B01P)
  • ITGB8 purified MaxPab mouse polyclonal antibody (B01P)

ITGB8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003696-B01P
ITGB8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ITGB8 protein.
Información adicional
Size 50 ug
Gene Name ITGB8
Gene Alias -
Gene Description integrin, beta 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGB8 (NP_002205, 1 a.a. ~ 769 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3696

Enviar un mensaje


ITGB8 purified MaxPab mouse polyclonal antibody (B01P)

ITGB8 purified MaxPab mouse polyclonal antibody (B01P)