ITGB8 polyclonal antibody (A01)
  • ITGB8 polyclonal antibody (A01)

ITGB8 polyclonal antibody (A01)

Ref: AB-H00003696-A01
ITGB8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGB8.
Información adicional
Size 50 uL
Gene Name ITGB8
Gene Alias -
Gene Description integrin, beta 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB8 (NP_002205, 392 a.a. ~ 503 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3696

Enviar un mensaje


ITGB8 polyclonal antibody (A01)

ITGB8 polyclonal antibody (A01)