ITGB6 monoclonal antibody (M03), clone 4C3
  • ITGB6 monoclonal antibody (M03), clone 4C3

ITGB6 monoclonal antibody (M03), clone 4C3

Ref: AB-H00003694-M03
ITGB6 monoclonal antibody (M03), clone 4C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGB6.
Información adicional
Size 100 ug
Gene Name ITGB6
Gene Alias -
Gene Description integrin, beta 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB6 (NM_000888, 604 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3694
Clone Number 4C3
Iso type IgG2a Kappa

Enviar un mensaje


ITGB6 monoclonal antibody (M03), clone 4C3

ITGB6 monoclonal antibody (M03), clone 4C3