ITGB3 polyclonal antibody (A01)
  • ITGB3 polyclonal antibody (A01)

ITGB3 polyclonal antibody (A01)

Ref: AB-H00003690-A01
ITGB3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGB3.
Información adicional
Size 50 uL
Gene Name ITGB3
Gene Alias CD61|GP3A|GPIIIa
Gene Description integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB3 (NP_000203, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3690

Enviar un mensaje


ITGB3 polyclonal antibody (A01)

ITGB3 polyclonal antibody (A01)