ITGB2 monoclonal antibody (M03), clone 3C7
  • ITGB2 monoclonal antibody (M03), clone 3C7

ITGB2 monoclonal antibody (M03), clone 3C7

Ref: AB-H00003689-M03
ITGB2 monoclonal antibody (M03), clone 3C7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ITGB2.
Información adicional
Size 100 ug
Gene Name ITGB2
Gene Alias CD18|LAD|LCAMB|LFA-1|MAC-1|MF17|MFI7
Gene Description integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq MLGLRPPLLALVGLLSLGCALSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB2 (AAH05861, 1 a.a. ~ 769 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3689
Clone Number 3C7
Iso type IgG2b Kappa

Enviar un mensaje


ITGB2 monoclonal antibody (M03), clone 3C7

ITGB2 monoclonal antibody (M03), clone 3C7