ITGB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ITGB2 purified MaxPab rabbit polyclonal antibody (D01P)

ITGB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003689-D01P
ITGB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ITGB2 protein.
Información adicional
Size 100 ug
Gene Name ITGB2
Gene Alias CD18|LAD|LCAMB|LFA-1|MAC-1|MF17|MFI7
Gene Description integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGB2 (AAH05861.1, 1 a.a. ~ 769 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3689

Enviar un mensaje


ITGB2 purified MaxPab rabbit polyclonal antibody (D01P)

ITGB2 purified MaxPab rabbit polyclonal antibody (D01P)