ITGAX purified MaxPab mouse polyclonal antibody (B01P)
  • ITGAX purified MaxPab mouse polyclonal antibody (B01P)

ITGAX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003687-B01P
ITGAX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ITGAX protein.
Información adicional
Size 50 ug
Gene Name ITGAX
Gene Alias CD11C|SLEB6
Gene Description integrin, alpha X (complement component 3 receptor 4 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGAX (ABM86623.1, 1 a.a. ~ 1169 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3687

Enviar un mensaje


ITGAX purified MaxPab mouse polyclonal antibody (B01P)

ITGAX purified MaxPab mouse polyclonal antibody (B01P)