ITGAX polyclonal antibody (A01)
  • ITGAX polyclonal antibody (A01)

ITGAX polyclonal antibody (A01)

Ref: AB-H00003687-A01
ITGAX polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGAX.
Información adicional
Size 50 uL
Gene Name ITGAX
Gene Alias CD11C|SLEB6
Gene Description integrin, alpha X (complement component 3 receptor 4 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGAX (NP_000878, 114 a.a. ~ 223 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3687

Enviar un mensaje


ITGAX polyclonal antibody (A01)

ITGAX polyclonal antibody (A01)