ITGAM polyclonal antibody (A01)
  • ITGAM polyclonal antibody (A01)

ITGAM polyclonal antibody (A01)

Ref: AB-H00003684-A01
ITGAM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGAM.
Información adicional
Size 50 uL
Gene Name ITGAM
Gene Alias CD11B|CR3A|MAC-1|MAC1A|MGC117044|MO1A|SLEB6
Gene Description integrin, alpha M (complement component 3 receptor 3 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGAM (NP_000623, 111 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3684

Enviar un mensaje


ITGAM polyclonal antibody (A01)

ITGAM polyclonal antibody (A01)