ITGAE monoclonal antibody (M01), clone 6B8
  • ITGAE monoclonal antibody (M01), clone 6B8

ITGAE monoclonal antibody (M01), clone 6B8

Ref: AB-H00003682-M01
ITGAE monoclonal antibody (M01), clone 6B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGAE.
Información adicional
Size 100 ug
Gene Name ITGAE
Gene Alias CD103|HUMINAE|MGC141996
Gene Description integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGAE (NP_002199, 57 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3682
Clone Number 6B8
Iso type IgG3 Kappa

Enviar un mensaje


ITGAE monoclonal antibody (M01), clone 6B8

ITGAE monoclonal antibody (M01), clone 6B8