ITGAD polyclonal antibody (A01)
  • ITGAD polyclonal antibody (A01)

ITGAD polyclonal antibody (A01)

Ref: AB-H00003681-A01
ITGAD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGAD.
Información adicional
Size 50 uL
Gene Name ITGAD
Gene Alias ADB2|CD11D|FLJ39841
Gene Description integrin, alpha D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RVCGENSYSKGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQFEGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGAD (NP_061194, 112 a.a. ~ 213 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3681

Enviar un mensaje


ITGAD polyclonal antibody (A01)

ITGAD polyclonal antibody (A01)