ITGA7 monoclonal antibody (M01), clone 8G2
  • ITGA7 monoclonal antibody (M01), clone 8G2

ITGA7 monoclonal antibody (M01), clone 8G2

Ref: AB-H00003679-M01
ITGA7 monoclonal antibody (M01), clone 8G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGA7.
Información adicional
Size 100 ug
Gene Name ITGA7
Gene Alias FLJ25220
Gene Description integrin, alpha 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA7 (NP_002197, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3679
Clone Number 8G2
Iso type IgG2a Kappa

Enviar un mensaje


ITGA7 monoclonal antibody (M01), clone 8G2

ITGA7 monoclonal antibody (M01), clone 8G2