ITGA4 monoclonal antibody (M01), clone 2C11
  • ITGA4 monoclonal antibody (M01), clone 2C11

ITGA4 monoclonal antibody (M01), clone 2C11

Ref: AB-H00003676-M01
ITGA4 monoclonal antibody (M01), clone 2C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGA4.
Información adicional
Size 100 ug
Gene Name ITGA4
Gene Alias CD49D|IA4|MGC90518
Gene Description integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA4 (NP_000876, 98 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3676
Clone Number 2C11
Iso type IgG1 Kappa

Enviar un mensaje


ITGA4 monoclonal antibody (M01), clone 2C11

ITGA4 monoclonal antibody (M01), clone 2C11